| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM67544 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 605±n/a nM |
|---|
| Comments | PDSP_1909 |
|---|
| Citation |  Korstanje, C; Sprenkels, R; Doods, HN; Hugtenburg, JG; Boddeke, E; Batink, HD; Thoolen, MJ; Van Zwieten, PA Characterization of flufylline, fluprofylline, ritanserin, butanserin and R 56413 with respect to in-vivo alpha 1-,alpha 2- and 5-HT2-receptor antagonism and in-vitro affinity for alpha 1-,alpha 2- and 5-HT2-receptors: comparison with ketanserin. J Pharm Pharmacol38:374-9 (1986) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM67544 |
|---|
| n/a |
|---|
| Name | BDBM67544 |
|---|
| Synonyms: | N,N-dimethyl-3-[2-(trifluoromethyl)-10-phenothiazinyl]-1-propanamine;hydrochloride | N,N-dimethyl-3-[2-(trifluoromethyl)phenothiazin-10-yl]propan-1-amine;hydrochloride | SR-01000000224-4 | TRIFLUPROMAZINE | cid_66069 | dimethyl-[3-[2-(trifluoromethyl)phenothiazin-10-yl]propyl]amine;hydrochloride | med.21724, Compound Triflupromazine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19F3N2S |
|---|
| Mol. Mass. | 352.417 |
|---|
| SMILES | CN(C)CCCN1c2ccccc2Sc2ccc(cc12)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
