Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM35234
Substrate/Competitorn/a
Ki 122±n/a nM
CommentsPDSP_1348
Citation Murphy TJBylund DB Characterization of alpha-2 adrenergic receptors in the OK cell, an opossum kidney cell line. J Pharmacol Exp Ther 244:571-8 (1988) [PubMed]
More Info.:Get all data from this article
 
adrenergic Alpha2
Name:adrenergic Alpha2
Synonyms:Alpha-2B adrenergic receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41875.91
Organism:OPOSSUM
Description:adrenergic Alpha2 0 OPOSSUM::O77715
Residue:382
Sequence:
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE
LLGYWYFRHTWCEVYLALDVLFCTSSIVHLCAISLDRYWSVSRALEYNSKRTPRRIKGII
LTVWLIAAFISLPPLIYKGDKGKKPGGRPQCKLNEEAWYILSSSIGSFFAPCLIMILVYL
RIYLIAKRRNRQGPHGKQAPGDGDTGPSALGGTSTISKLPPSILPAVGEANGHSKPPGER
EGGEQMGDPTSPSTPPNQSSVGPEDGSQKQEEEEEEEEEEEEECGPPAPPTSSSLQGTPN
FQPSQGSQVLATLRGQVLLARGPASLGLQPWRRRTQMNREKRFTFVLAVVIGVFVLCWFP
FFFSYSLGAICPQHCKVPHGLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35234
n/a
NameBDBM35234
Synonyms:DL-[7-3H]norepinephrine | NOREPINEPHRINE | Noradrenaline,(+) | [3H]NE
Typeradiolabeled ligand
Emp. Form.C8H11NO3
Mol. Mass.169.1778
SMILESNCC(O)c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: