Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50002051 |
---|
Substrate/Competitor | n/a |
---|
Ki | 23±n/a nM |
---|
Comments | PDSP_643 |
---|
Citation | Mendelsohn, LG; Kalra, V; Johnson, BG; Kerchner, GA Sigma opioid receptor: characterization and co-identity with the phencyclidine receptor. J Pharmacol Exp Ther233:597-602 (1985) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50002051 |
---|
n/a |
---|
Name | BDBM50002051 |
Synonyms: | (+/-)-(2RS)-2-[(4RS)-2,2-Diphenyl-1,3-dioxolan-4-yl]piperidine | (+/-)-(2RS)-2-[(4SR)-2,2-diphenyl-1,3-dioxolan-4-yl]piperidine | (Dexoxadrol)2-(2,2-Diphenyl-[1,3]dioxolan-4-yl)-piperidine | CHEMBL26479 | Dexoxadrol |
Type | Small organic molecule |
Emp. Form. | C20H23NO2 |
Mol. Mass. | 309.4021 |
SMILES | C1OC(OC1C1CCCCN1)(c1ccccc1)c1ccccc1 |
Structure |
|