| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM82004 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 8±n/a nM |
|---|
| Comments | PDSP_1442 |
|---|
| Citation |  Mendelsohn, LG; Kalra, V; Johnson, BG; Kerchner, GA Sigma opioid receptor: characterization and co-identity with the phencyclidine receptor. J Pharmacol Exp Ther233:597-602 (1985) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM82004 |
|---|
| n/a |
|---|
| Name | BDBM82004 |
|---|
| Synonyms: | PCP,m-OH |
|---|
| Type | n/a |
|---|
| Emp. Form. | C18H27N |
|---|
| Mol. Mass. | 257.4137 |
|---|
| SMILES | Cc1cccc(c1)C1(CCCCC1)N1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
