Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50001031 |
---|
Substrate/Competitor | n/a |
---|
Ki | 571±n/a nM |
---|
Comments | PDSP_1714 |
---|
Citation | Mendelsohn, LG; Kalra, V; Johnson, BG; Kerchner, GA Sigma opioid receptor: characterization and co-identity with the phencyclidine receptor. J Pharmacol Exp Ther233:597-602 (1985) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50001031 |
---|
n/a |
---|
Name | BDBM50001031 |
Synonyms: | 3-Allyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | CHEMBL330376 | SKF 10,047 (+) | SKF 10,047 (-) | SKF 10047 |
Type | Small organic molecule |
Emp. Form. | C17H23NO |
Mol. Mass. | 257.3706 |
SMILES | C[C@H]1[C@H]2Cc3ccc(O)cc3[C@@]1(C)CCN2CC=C |TLB:16:15:1:10.4.3| |
Structure |
|