Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM81768
Substrate/Competitorn/a
Ki 0.4±n/a nM
CommentsPDSP_2042
Citation Yamamura HISnyder SH Muscarinic cholinergic binding in rat brain. Proc Natl Acad Sci U S A 71:1725-9 (1974) [PubMed]  Article
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic receptor M2 and M3
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81768
n/a
NameBDBM81768
Synonyms:BENZYLIC ACID | CAS_6581-06-2 | NSC_5311391 | Quinuclidinyl benzilate
TypeSmall organic molecule
Emp. Form.C14H12O3
Mol. Mass.228.2433
SMILESOC(=O)C(O)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: