Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGDR
LigandBDBM50020300
Substrate/Competitorn/a
Ki 693±n/a nM
CommentsPDSP_1467
Citation Shimizu TYamashita AHayaishi O Specific binding of prostaglandin D2 to rat brain synaptic membrane. Occurrence, properties, and distribution. J Biol Chem 257:13570-5 (1982) [PubMed]
More Info.:Get all data from this article
 
PTGDR
Name:PTGDR
Synonyms:Prostaglandin D2 | Prostaglandin D2 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39786.91
Organism:RAT
Description:Prostaglandin D2 PTGDR RAT::Q9R261
Residue:357
Sequence:
MNESYRCQAATWVERGSSATMGGVAFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF
YVLVCGLTVTDLLGKCLISPMVLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTL
QLLAMALECWLSLGHPFFYQRHITARRGVLVAPVAGAFSLAFCALPFAGFGKFVQYCPGT
WCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRRQRHHPRRCSR
DRAQSGSDYRHGSPNPLEELDHFVLLALTTVLFTMCSLPLIYRAYYGAFKLVDRADGDSE
DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKTFTRPLIYRNWCSHSWQTNMESTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020300
n/a
NameBDBM50020300
Synonyms:(S-isomer)7-[3,5-Dihydroxy-2-(3-hydroxy-oct-1-enyl)-cyclopentyl]-hept-5-enoic acid | (Z)-7-[(1R,3R,5S)-3,5-Dihydroxy-2-((E)-(S)-3-hydroxy-oct-1-enyl)-cyclopentyl]-hept-5-enoic acid | 7-[3,5-Dihydroxy-2-(3-hydroxy-oct-1-enyl)-cyclopentyl]-hept-5-enoic acid | CHEMBL12114 | PGF2Alpha | Prostaglandin F2alpha7-[3,5-Dihydroxy-2-(3-hydroxy-oct-1-enyl)-cyclopentyl]-hept-5-enoic acid
TypeSmall organic molecule
Emp. Form.C20H34O5
Mol. Mass.354.481
SMILESCCCCC[C@H](O)\C=C\C1[C@H](O)C[C@H](O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: