Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTBXA2R
LigandBDBM35847
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1462
Citation Armstrong RAJones RLWilson NH Ligand binding to thromboxane receptors on human platelets: correlation with biological activity. Br J Pharmacol 79:953-64 (1983) [PubMed]  Article
More Info.:Get all data from this article
 
TBXA2R
Name:TBXA2R
Synonyms:Thromboxane A2
Type:Enzyme Catalytic Domain
Mol. Mass.:37114.77
Organism:MOUSE
Description:Thromboxane A2 TBXA2R MOUSE::P30987
Residue:341
Sequence:
MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS
SFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLL
LGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSW
CFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEM
MVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQIL
DPWVYILFRRSVLRRLHPRFSSQLQAVSLRRPPAQAMLSGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35847
n/a
NameBDBM35847
Synonyms:(15S)-prostaglandin E2 | (5Z,11alpha,13E,15S)-11,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (E,Z)-(1R,2R,3R)-7-(3-Hydroxy-2-((3S)-(3-hydroxy-1-octenyl))-5-oxocyclopentyl)-5-heptenoic acid | CHEMBL548 | DINOPROSTONE | PGE2 | [3H]Dinoprostone | [3H]PGE2 | [3H]Prostaglandin E2 | prostaglandin E2
Typeradiolabeled ligand
Emp. Form.C20H32O5
Mol. Mass.352.4651
SMILESCCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: