Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM21397
Substrate/Competitorn/a
Ki 0.39±n/a nM
CommentsPDSP_1739
Citation Zahniser NRDubocovich ML Comparison of dopamine receptor sites labeled by [3H]-S-sulpiride and [3H]-spiperone in striatum. J Pharmacol Exp Ther 227:592-9 (1983) [PubMed]
More Info.:Get all data from this article
 
DRD2
Name:DRD2
Synonyms:DOPAMINE D2
Type:Enzyme Catalytic Domain
Mol. Mass.:50660.69
Organism:RABBIT
Description:DOPAMINE D2 DRD2 RABBIT::G1T1Q0
Residue:443
Sequence:
MDPLNLSWYDEDLERQNWSRPLNGSEGRGDRPHYNYYAMLLTLLIFVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRVHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSLTISCPLLFGLNKTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLRAPL
KGNCTHPEDRTLGTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21397
n/a
NameBDBM21397
Synonyms:8-[4-(4-fluorophenyl)-4-keto-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxidanylidene-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxobutyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL267930 | MLS000028615 | SMR000058674 | SPIPERONE | Spiroperidol | US9359372, Spiperone | [3H]-Spiroperidol | cid_5265
Typeradiolabeled ligand
Emp. Form.C23H26FN3O2
Mol. Mass.395.4698
SMILESFc1ccc(cc1)C(=O)CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: