Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine 1D receptor |
---|
Ligand | BDBM50252513 |
---|
Substrate/Competitor | n/a |
---|
Ki | 117±n/a nM |
---|
Comments | PDSP_1600 |
---|
Citation | Leysen, JE; Janssen, PM; Megens, AA; Schotte, A Risperidone: a novel antipsychotic with balanced serotonin-dopamine antagonism, receptor occupancy profile, and pharmacologic activity. J Clin Psychiatry0:5-12 (1994) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine 1D receptor |
---|
Name: | 5-hydroxytryptamine 1D receptor |
Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
Type: | Protein |
Mol. Mass.: | 12731.52 |
Organism: | Bos taurus (Bovine) |
Description: | Q8MI13 |
Residue: | 119 |
Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
BDBM50252513 |
---|
n/a |
---|
Name | BDBM50252513 |
Synonyms: | 3-(2-(4-(6-fluorobenzo[d]isoxazol-3-yl)piperidin-1-yl)ethyl)-9-hydroxy-2-methyl-6,7,8,9-tetrahydropyrido[1,2-a]pyrimidin-4-one | 9-OH-risperidone | 9-hydroxy risperidone | CHEMBL1621 | Invega | PALIPERIDONE |
Type | Small organic molecule |
Emp. Form. | C23H27FN4O3 |
Mol. Mass. | 426.4839 |
SMILES | Cc1nc2C(O)CCCn2c(=O)c1CCN1CCC(CC1)c1noc2cc(F)ccc12 |
Structure |
|