Reaction Details |
| Report a problem with these data |
Target | Gamma-aminobutyric acid receptor subunit alpha-1 |
---|
Ligand | BDBM26266 |
---|
Substrate/Competitor | n/a |
---|
Ki | 26±n/a nM |
---|
Comments | PDSP_2001 |
---|
Citation | Giorgi, O; Lecca, D; Cancedda, E; Serra, GP; Corda, MG Modulation of [35S]TBPS binding by ligands with preferential affinity for benzodiazepine BZ1 sites in the cerebral cortex of newborn and adult rats. Eur J Pharmacol290:37-47 (1995) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Gamma-aminobutyric acid receptor subunit alpha-1 |
---|
Name: | Gamma-aminobutyric acid receptor subunit alpha-1 |
Synonyms: | Benzodiazepine central | Benzodiazepine receptors | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | GBRA1_RAT | Gabra-1 | Gabra1 | TBPS |
Type: | Enzyme |
Mol. Mass.: | 51770.21 |
Organism: | Rattus norvegicus (Rat) |
Description: | P62813 |
Residue: | 455 |
Sequence: | MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
|
|
|
BDBM26266 |
---|
n/a |
---|
Name | BDBM26266 |
Synonyms: | Ambien | CHEMBL911 | Dalparan | N,N-dimethyl-2-[6-methyl-2-(4-methylphenyl)imidazo[1,2-a]pyridin-3-yl]acetamide | ZPM | Zolpidem | Zolpidem tartrate |
Type | Small organic molecule |
Emp. Form. | C19H21N3O |
Mol. Mass. | 307.3895 |
SMILES | CN(C)C(=O)Cc1c(nc2ccc(C)cn12)-c1ccc(C)cc1 |
Structure |
|