Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50008984 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1.3±n/a nM |
---|
Comments | PDSP_818 |
---|
Citation | Raynor, K; Kong, H; Mestek, A; Bye, LS; Tian, M; Liu, J; Yu, L; Reisine, T Characterization of the cloned human mu opioid receptor. J Pharmacol Exp Ther272:423-8 (1995) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | OPRM_RAT | Opiate non-selective | Opioid receptor B | Oprm1 | Ror-b |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44503.11 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor. |
Residue: | 398 |
Sequence: | MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
|
|
|
BDBM50008984 |
---|
n/a |
---|
Name | BDBM50008984 |
Synonyms: | 4-(4-Chloro-benzyl)-2-(1-methyl-azepan-4-yl)-2H-phthalazin-1-one | CHEMBL596 | Duragesic-100 | Duragesic-12 | Duragesic-25 | Duragesic-50 | Duragesic-75 | FENTANYL | FENTANYL CITRATE | FENTANYL-HCl | Fentanyl-100 | Fentanyl-12 | Fentanyl-25 | Fentanyl-50 | Fentanyl-75 | Fentora | Innovar | Ionsys | N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide | N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide(Fentanyl) | N-(1-phenethylpiperidin-4-yl)-N-phenylpropionamide | US20230399418, Compound Fentanyl |
Type | Small organic molecule |
Emp. Form. | C22H28N2O |
Mol. Mass. | 336.4705 |
SMILES | CCC(=O)N(C1CCN(CCc2ccccc2)CC1)c1ccccc1 |
Structure |
|