Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR5
LigandBDBM82470
Substrate/Competitorn/a
Ki 0.10±n/a nM
CommentsPDSP_373
Citation Hoyer DLübbert HBruns C Molecular pharmacology of somatostatin receptors. Naunyn Schmiedebergs Arch Pharmacol 350:441-53 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
SSTR5
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST5 | Somatostatin receptor type 5
Type:Enzyme Catalytic Domain
Mol. Mass.:39986.50
Organism:RAT
Description:SOMATOSTATIN SST5 SSTR5 RAT::P30938
Residue:363
Sequence:
MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIY
VVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVVSYWPFGSFLCRLVMTLDGIN
QFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQE
GWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRR
RSEPKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCAN
PLLYGFLSDNFRQSFRKVLCLRRGYGMEDADAIEPRPDKSGRPQATLPTRSCEANGLMQT
SRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82470
n/a
NameBDBM82470
Synonyms:3-(2-Naphtyl)-D-Ala-L-Cys(1)-L-Tyr-D-Trp-L-Lys-L-Val-L-Cys(1)-L-Thr-NH2 | BIM 23014 | BIM-23014 | LANREOTIDE
TypeSmall organic molecule
Emp. Form.C54H69N11O10S2
Mol. Mass.1096.323
SMILESCC(C)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](CSSC[C@H](NC1=O)C(=O)N[C@@H]([C@@H](C)O)C(N)=O)NC(=O)[C@H](N)Cc1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: