Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2B (5HT2B)
LigandBDBM50014406
Substrate/Competitorn/a
Ki 6606.93±n/a nM
CommentsPDSP_154
Citation Boess FGMartin IL Molecular biology of 5-HT receptors. Neuropharmacology 33:275-317 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 2B (5HT2B)
Name:Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Synonyms:5-HT2 | 5-HT2B | 5-hydroxytryptamine receptor 2B | HTR2B
Type:Enzyme
Mol. Mass.:53610.91
Organism:Mus musculus (Mouse)
Description:Q02152
Residue:479
Sequence:
MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQTVEGQGHTVHWAALLI
LAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGLFVMPIALLTIMFEAIW
PLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRATAFIKITVVWL
ISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSLAAFFAPLTIMVVTYFLTI
HTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKVAMLDGSHRDKILPNSSDETL
MRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFFITNLTLALCDSCNQTTLKTL
LEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYRATKSVKALRKFSSTLCFGNSM
VENSKFFTKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLTENDGDKAEEQVSYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014406
n/a
NameBDBM50014406
Synonyms:2-Me 5-HT | 2-Methyl-5-hydroxytryptamine | 2-methyl-5-HT | 2-methylserotonin | 3-(2-aminoethyl)-2-methyl-1H-indol-5-ol | 5-HT,2-Me | CHEMBL266591
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESCc1[nH]c2ccc(O)cc2c1CCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: