Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT3A Serotonin Receptor
LigandBDBM10755
Substrate/Competitorn/a
Ki 269.15±n/a nM
CommentsPDSP_150
Citation Boess FGMartin IL Molecular biology of 5-HT receptors. Neuropharmacology 33:275-317 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
5-HT3A Serotonin Receptor
Name:5-HT3A Serotonin Receptor
Synonyms:5-HT-3 | 5-HT3-A | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 | 5-hydroxytryptamine receptor 3A | 5ht3 | Htr3 | Htr3a | Serotonin 3 receptor (5HT3) | Serotonin 3a (5-HT3a) receptor | Serotonin receptor 3A | Serotonin-gated ion channel receptor
Type:n/a
Mol. Mass.:56056.00
Organism:Mus musculus (house mouse)
Description:5HT3A
Residue:487
Sequence:
MRLCIPQVLLALFLSMLTAPGEGSRRRATQEDTTQPALLRLSDHLLANYKKGVRPVRDWR
KPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIW
VPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFT
SWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYV
IIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLP
ATIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCL
GEQPMAHRPPATFQANKTDDCSGSDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPREA
SLAVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTL
WSIWHYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: