Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor beta
LigandBDBM29525
Substrate/Competitorn/a
Ki 7943.28±n/a nM
CommentsPDSP_880
Citation Gale JDGrossman CJWhitehead JWOxford AWBunce KTHumphrey PP GR113808: a novel, selective antagonist with high affinity at the 5-HT4 receptor. Br J Pharmacol 111:332-8 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Adrenergic receptor beta
Name:Adrenergic receptor beta
Synonyms:ADRB1R, B1AR | Beta-1 adrenergic receptor | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1 | adrenergic Beta1,2
Type:Protein
Mol. Mass.:50486.84
Organism:Rattus norvegicus (Rat)
Description:P18090
Residue:466
Sequence:
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG
MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRP
SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA
FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD
DDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29525
n/a
NameBDBM29525
Synonyms:3H-GR113808 | CHEMBL518682 | GR 113808 | [3H] GR 113808 | [3H]GR113808
Typeradiolabeled ligand
Emp. Form.C19H27N3O4S
Mol. Mass.393.5
SMILESCn1cc(C(=O)OCC2CCN(CCNS(C)(=O)=O)CC2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: