Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM29525
Substrate/Competitorn/a
Ki 6309.57±n/a nM
CommentsPDSP_880
Citation Gale JDGrossman CJWhitehead JWOxford AWBunce KTHumphrey PP GR113808: a novel, selective antagonist with high affinity at the 5-HT4 receptor. Br J Pharmacol 111:332-8 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic receptor M1 and M2
Synonyms:Cholinergic, muscarinic M1 | Chrm-1 | Chrm1 | cholinergic receptor, muscarinic 1
Type:Enzyme Catalytic Domain
Mol. Mass.:51390.46
Organism:RAT
Description:Cholinergic, muscarinic M1 CHRM1 RAT::P08482
Residue:460
Sequence:
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDSEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29525
n/a
NameBDBM29525
Synonyms:3H-GR113808 | CHEMBL518682 | GR 113808 | [3H] GR 113808 | [3H]GR113808
Typeradiolabeled ligand
Emp. Form.C19H27N3O4S
Mol. Mass.393.5
SMILESCn1cc(C(=O)OCC2CCN(CCNS(C)(=O)=O)CC2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: