| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melatonin receptor |
|---|
| Ligand | BDBM82087 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 4600±n/a nM |
|---|
| Comments | PDSP_7422 |
|---|
| Citation |  Morgan, PJ; Barrett, P; Howell, HE; Helliwell, R Melatonin receptors: localization, molecular pharmacology and physiological significance. Neurochem Int24:101-46 (1994) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Melatonin receptor |
|---|
| Name: | Melatonin receptor |
|---|
| Synonyms: | Melatonin | Melatonin receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13287.02 |
|---|
| Organism: | RABBIT |
|---|
| Description: | Q9BE38 |
|---|
| Residue: | 114 |
|---|
| Sequence: | MIWMLTLVAVMPNLHTGTLQYDPRVYSCTFSQSVSSAYTIAVVVFHFIIPMLMSSCCYLR
IWILVLQVRRRVKPDNKPKLKPQDFRNFITMFVVFVLFAICWAPLNFIVLLGRS
|
|
|
|---|
| BDBM82087 |
|---|
| n/a |
|---|
| Name | BDBM82087 |
|---|
| Synonyms: | 2-(5-methoxy-1H-indol-3-yl)ethanamine | 5-MT | 5-Methoxytryptamine hydrochloride | CAS_66-83-1 | tryptamine, 5-Methoxy |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H14N2O |
|---|
| Mol. Mass. | 190.2417 |
|---|
| SMILES | COc1ccc2[nH]cc(CCN)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
