| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transmembrane and immunoglobulin domain-containing 3 |
|---|
| Ligand | BDBM50021484 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 33.1±n/a nM |
|---|
| Comments | PDSP_2898 |
|---|
| Citation |  Olah, ME; Gallo-Rodriguez, C; Jacobson, KA; Stiles, GL 125I-4-aminobenzyl-5'-N-methylcarboxamidoadenosine, a high affinity radioligand for the rat A3 adenosine receptor. Mol Pharmacol45:978-82 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Transmembrane and immunoglobulin domain-containing 3 |
|---|
| Name: | Transmembrane and immunoglobulin domain-containing 3 |
|---|
| Synonyms: | ADENOSINE A3 | ADORA3 | Adora3 protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25707.75 |
|---|
| Organism: | RAT |
|---|
| Description: | Q4V8H0 |
|---|
| Residue: | 232 |
|---|
| Sequence: | MEPLLLLSLALFSDAMVMDEKVKSGVELDTASAICNYDAHYKDHTKYWCRGYFRDSCNII
AFTPNSSNRVALKDTGDQLIITVSCLVKEDTGWYWCGIQRDFARDDMDFTKLIVTDNRED
RANGLSPGTSGNRTRSCKTSKAVQKAEGSRMSILIVCVLISGLGIIFLISHMSRGRRSQR
NRGVTGKSINRNPQASQAPSMVSIPLTVLPKVPRQNGQQKALQWTGNATKTG
|
|
|
|---|
| BDBM50021484 |
|---|
| n/a |
|---|
| Name | BDBM50021484 |
|---|
| Synonyms: | 5-(6-Cyclohexylamino-purin-9-yl)-3,4-dihydroxy-tetrahydro-furan-2-carboxylic acid ethylamide | Cyclohexyl-NECA | N6-CyclohexylNECA |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H26N6O4 |
|---|
| Mol. Mass. | 390.4368 |
|---|
| SMILES | CCNC(=O)C1OC(C(O)C1O)n1cnc2c(NC3CCCCC3)ncnc12 |
|---|
| Structure | 
|
|---|
Search and Browse
