| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
|---|
| Ligand | BDBM52017 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay |
|---|
| IC50 | 1544±64 nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
|---|
| Name: | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
|---|
| Synonyms: | CTDS1_HUMAN | CTDSP1 | NIF3 | NLIIF | SCP1 | carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 29199.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_10864009 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGA
PLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEI
DGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRES
CVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPF
FEQLSRVDDVYSVLRQPRPGS
|
|
|
|---|
| BDBM52017 |
|---|
| n/a |
|---|
| Name | BDBM52017 |
|---|
| Synonyms: | 2,6-Dibromo-4-[(3-mercapto-5-phenyl-[1,2,4]triazol-4-ylimino)-methyl]-phenol | 2,6-bis(bromanyl)-4-[[(3-phenyl-5-sulfanylidene-1H-1,2,4-triazol-4-yl)amino]methylidene]cyclohexa-2,5-dien-1-one | 2,6-dibromo-4-[[(3-phenyl-5-sulfanylidene-1H-1,2,4-triazol-4-yl)amino]methylidene]-1-cyclohexa-2,5-dienone | 2,6-dibromo-4-[[(3-phenyl-5-sulfanylidene-1H-1,2,4-triazol-4-yl)amino]methylidene]cyclohexa-2,5-dien-1-one | 2,6-dibromo-4-[[(3-phenyl-5-thioxo-1H-1,2,4-triazol-4-yl)amino]methylene]cyclohexa-2,5-dien-1-one | MLS001209760 | SMR000513433 | cid_5753333 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10Br2N4OS |
|---|
| Mol. Mass. | 454.139 |
|---|
| SMILES | Oc1c(Br)cc(C=Nn2c(n[nH]c2=S)-c2ccccc2)cc1Br |w:7.7| |
|---|
| Structure | 
|
|---|
Search and Browse
