| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Endoribonuclease toxin MazF |
|---|
| Ligand | BDBM61783 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SAR analysis of small molecule activators of the MazEF TA System via a fluorescence-based single-stranded RNase assay |
|---|
| EC50 | 26900±n/a nM |
|---|
| Citation |  PubChem, PC SAR analysis of small molecule activators of the MazEF TA System via a fluorescence-based single-stranded RNase assay PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Endoribonuclease toxin MazF |
|---|
| Name: | Endoribonuclease toxin MazF |
|---|
| Synonyms: | MAZF_ECOLI | chpA | chpAK | mRNA interferase toxin, antitoxin is MazE | mazF |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12100.43 |
|---|
| Organism: | Escherichia coli str. K-12 substr. MG1655 |
|---|
| Description: | gi_16130689 |
|---|
| Residue: | 111 |
|---|
| Sequence: | MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPF
EVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
|
|
|
|---|
| BDBM61783 |
|---|
| n/a |
|---|
| Name | BDBM61783 |
|---|
| Synonyms: | 1-(2,4-dichlorophenyl)-3-[1-(4-fluorophenyl)sulfonyl-4-piperidinyl]urea | 1-(2,4-dichlorophenyl)-3-[1-(4-fluorophenyl)sulfonyl-4-piperidyl]urea | 1-(2,4-dichlorophenyl)-3-[1-(4-fluorophenyl)sulfonylpiperidin-4-yl]urea | MLS000544968 | N-(2,4-dichlorophenyl)-N'-{1-[(4-fluorophenyl)sulfonyl]-4-piperidinyl}urea | SMR000126725 | cid_3562031 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18Cl2FN3O3S |
|---|
| Mol. Mass. | 446.323 |
|---|
| SMILES | Fc1ccc(cc1)S(=O)(=O)N1CCC(CC1)NC(=O)Nc1ccc(Cl)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
