Reaction Details |
| Report a problem with these data |
Target | Endoribonuclease toxin MazF |
---|
Ligand | BDBM83587 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | SAR analysis of small molecule activators of the MazEF TA System via a fluorescence-based single-stranded RNase assay |
---|
EC50 | 6630±n/a nM |
---|
Citation | PubChem, PC SAR analysis of small molecule activators of the MazEF TA System via a fluorescence-based single-stranded RNase assay PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Endoribonuclease toxin MazF |
---|
Name: | Endoribonuclease toxin MazF |
Synonyms: | MAZF_ECOLI | chpA | chpAK | mRNA interferase toxin, antitoxin is MazE | mazF |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 12100.43 |
Organism: | Escherichia coli str. K-12 substr. MG1655 |
Description: | gi_16130689 |
Residue: | 111 |
Sequence: | MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPF
EVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
|
|
|
BDBM83587 |
---|
n/a |
---|
Name | BDBM83587 |
Synonyms: | (5-amino-1-methylsulfonylpyrazol-3-yl) 2-methyl-3-nitrobenzoate | (5-azanyl-1-methylsulfonyl-pyrazol-3-yl) 2-methyl-3-nitro-benzoate | 2-methyl-3-nitro-benzoic acid (5-amino-1-mesyl-pyrazol-3-yl) ester | 2-methyl-3-nitrobenzoic acid (5-amino-1-methylsulfonyl-3-pyrazolyl) ester | MLS000680202 | SMR000324479 | cid_4461783 |
Type | Small organic molecule |
Emp. Form. | C12H12N4O6S |
Mol. Mass. | 340.312 |
SMILES | Cc1c(cccc1[N+]([O-])=O)C(=O)Oc1cc(N)n(n1)S(C)(=O)=O |
Structure |
|