Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetToll-like receptor 7
LigandBDBM273320
Substrate/Competitorn/a
Meas. Tech.TLR7/8/9 Inhibition Reporter Assay
Temperature298.15±n/a K
IC50 0.300±n/a nM
Commentsextracted
Citation Dyckman AJDodd DSMacor JEMussari CPPasunoori LKumar SRSherwood TCSistla RK [1,2,4]triazolo[1,5-a]pyridinyl substituted indole compounds US Patent  US10071079 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
Toll-like receptor 7
Name:TLR7 and TLR8
Synonyms:ORF Names:UNQ248/PRO285 | TLR7 | Toll-like receptor 7 (TLR7)
Type:Enzyme
Mol. Mass.:120945.35
Organism:Homo sapiens (Human)
Description:Q9NYK1
Residue:1049
Sequence:
MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP
GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP
RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG
QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI
QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM
NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK
EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP
LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN
SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN
CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL
HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK
YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ
AHPYFWQCLKNALATDNHVAYSQVFKETV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM273320
n/a
NameBDBM273320
Synonyms:8-ethyl-6-(3-isopropyl-5-(piperidin-4-yl)-1H-indol-2-yl)-[1,2,4]triazolo[1,5-a]pyridine | US10071079, Example 94
TypeSmall organic molecule
Emp. Form.C24H29N5
Mol. Mass.387.5206
SMILESCCc1cc(cn2ncnc12)-c1[nH]c2ccc(cc2c1C(C)C)C1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: