| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM84511 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Phosphatase Inhibition Assay |
|---|
| pH | 6.5±0 |
|---|
| Temperature | 310.15±0 K |
|---|
| IC50 | 8e+3± 5e+3 nM |
|---|
| Citation |  Fürstner, A; Reinecke, K; Prinz, H; Waldmann, H The core structures of roseophilin and the prodigiosin alkaloids define a new class of protein tyrosine phosphatase inhibitors. Chembiochem5:1575-9 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM84511 |
|---|
| n/a |
|---|
| Name | BDBM84511 |
|---|
| Synonyms: | Acyclic analogue, 16 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H20N2O2 |
|---|
| Mol. Mass. | 272.3422 |
|---|
| SMILES | COC1=CC(=O)N\C1=C/c1ccc(CCCCC=C)[nH]1 |t:2| |
|---|
| Structure | 
|
|---|
Search and Browse
