| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kit ligand |
|---|
| Ligand | BDBM54680 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| pH | 7±0 |
|---|
| Temperature | 295.15±0 K |
|---|
| IC50 | >1.0e+4±n/a nM |
|---|
| Citation |  Jautelat, R; Brumby, T; Schäfer, M; Briem, H; Eisenbrand, G; Schwahn, S; Krüger, M; Lücking, U; Prien, O; Siemeister, G From the insoluble dye indirubin towards highly active, soluble CDK2-inhibitors. Chembiochem6:531-40 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Kit ligand |
|---|
| Name: | Kit ligand |
|---|
| Synonyms: | KITLG | MGF | Mast cell growth factor | SCF | SCF_HUMAN | c-Kit | c-Kit ligand |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30897.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21583 |
|---|
| Residue: | 273 |
|---|
| Sequence: | MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV
|
|
|
|---|
| BDBM54680 |
|---|
| n/a |
|---|
| Name | BDBM54680 |
|---|
| Synonyms: | (3Z)-5-bromanyl-3-(3-oxidanylidene-1H-indol-2-ylidene)-1H-indol-2-one | (3Z)-5-bromo-3-(3-ketoindolin-2-ylidene)oxindole | (3Z)-5-bromo-3-(3-oxo-1H-indol-2-ylidene)-1H-indol-2-one | UNM-0000305770 | cid_5287845 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H9BrN2O2 |
|---|
| Mol. Mass. | 341.159 |
|---|
| SMILES | Brc1ccc2NC(=O)C(=C3Nc4ccccc4C3=O)c2c1 |w:8.20| |
|---|
| Structure | 
|
|---|
Search and Browse
