Reaction Details |
| Report a problem with these data |
Target | Kit ligand |
---|
Ligand | BDBM84555 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
pH | 7±0 |
---|
Temperature | 295.15±0 K |
---|
IC50 | >1.0e+4±n/a nM |
---|
Citation | Jautelat, R; Brumby, T; Schäfer, M; Briem, H; Eisenbrand, G; Schwahn, S; Krüger, M; Lücking, U; Prien, O; Siemeister, G From the insoluble dye indirubin towards highly active, soluble CDK2-inhibitors. Chembiochem6:531-40 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Kit ligand |
---|
Name: | Kit ligand |
Synonyms: | KITLG | MGF | Mast cell growth factor | SCF | SCF_HUMAN | c-Kit | c-Kit ligand |
Type: | Protein |
Mol. Mass.: | 30897.20 |
Organism: | Homo sapiens (Human) |
Description: | P21583 |
Residue: | 273 |
Sequence: | MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV
|
|
|
BDBM84555 |
---|
n/a |
---|
Name | BDBM84555 |
Synonyms: | Indirubin derivative, 30a | Indirubin derivative, 30b |
Type | Small organic molecule |
Emp. Form. | C24H28N4O4S |
Mol. Mass. | 468.569 |
SMILES | CN(C)CCN(C)S(=O)(=O)c1ccc2NC(=O)C(C3=Nc4ccccc4C3(O)CC=C)c2c1 |t:18| |
Structure |
|