Reaction Details |
| Report a problem with these data |
Target | Fibroblast growth factor 1 |
---|
Ligand | BDBM84562 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay |
---|
pH | 7.4±0 |
---|
Kd | 7.2±0.6 nM |
---|
Citation | Cochran, S; Li, CP; Bytheway, I An experimental and molecular-modeling study of the binding of linked sulfated tetracyclitols to FGF-1 and FGF-2. Chembiochem6:1882-90 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Fibroblast growth factor 1 |
---|
Name: | Fibroblast growth factor 1 |
Synonyms: | Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | FGF1 | FGF1_HUMAN | FGFA | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF |
Type: | Protein |
Mol. Mass.: | 17461.01 |
Organism: | Homo sapiens (Human) |
Description: | P05230 |
Residue: | 155 |
Sequence: | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
|
|
BDBM84562 |
---|
n/a |
---|
Name | BDBM84562 |
Synonyms: | Linked sulfated tetracyclitol, 3 |
Type | Small organic molecule |
Emp. Form. | C27H30N2O48S12 |
Mol. Mass. | 1535.298 |
SMILES | [O-]S(=O)(=O)O[C@@H]1C=C[C@@H]([C@@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O)N(CCCN([C@H]1C=C[C@@H](OS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O)[C@H]1C=C[C@@H](OS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O)[C@H]1C=C[C@@H](OS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O |r,c:6,28,50,72| |
Structure |
|