| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fibroblast growth factor 1 |
|---|
| Ligand | BDBM84569 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| pH | 7.4±0 |
|---|
| Kd | 115±17 nM |
|---|
| Citation |  Cochran, S; Li, CP; Bytheway, I An experimental and molecular-modeling study of the binding of linked sulfated tetracyclitols to FGF-1 and FGF-2. Chembiochem6:1882-90 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Fibroblast growth factor 1 |
|---|
| Name: | Fibroblast growth factor 1 |
|---|
| Synonyms: | Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | FGF1 | FGF1_HUMAN | FGFA | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17461.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05230 |
|---|
| Residue: | 155 |
|---|
| Sequence: | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
|
|
|---|
| BDBM84569 |
|---|
| n/a |
|---|
| Name | BDBM84569 |
|---|
| Synonyms: | Linked sulfated tetracyclitol, 10 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H44N2O48S12 |
|---|
| Mol. Mass. | 1633.484 |
|---|
| SMILES | [O-]S(=O)(=O)O[C@@H]1C=C[C@@H]([C@@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O)N(CCCCCCCCCCN([C@H]1C=C[C@@H](OS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O)[C@H]1C=C[C@@H](OS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O)[C@H]1C=C[C@@H](OS([O-])(=O)=O)[C@@H](OS([O-])(=O)=O)[C@@H]1OS([O-])(=O)=O |r,c:6,35,57,79| |
|---|
| Structure | 
|
|---|
Search and Browse
