Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR4
LigandBDBM82462
Substrate/Competitorn/a
Ki 0.08±n/a nM
CommentsPDSP_388
Citation Raynor KO'Carroll AMKong HYasuda KMahan LCBell GIReisine T Characterization of cloned somatostatin receptors SSTR4 and SSTR5. Mol Pharmacol 44:385-92 (1993) [PubMed]
More Info.:Get all data from this article
 
SSTR4
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST4 | Somatostatin receptor type 4
Type:Enzyme Catalytic Domain
Mol. Mass.:42096.84
Organism:RAT
Description:SOMATOSTATIN SST4 SSTR4 RAT::P30937
Residue:384
Sequence:
MNTPATLPLGGEDTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVG
NALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLS
VDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVF
ADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR
AGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANS
CANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGPGCICPPL
PCQQEPMQAEPACKRVPFTKTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82462
n/a
NameBDBM82462
Synonyms:BIM 23059 | D-Nal-c[Cys-Tyr-D-Trp-Lys-Thr-Cys]-Thr-NH2
TypeSmall organic molecule
Emp. Form.C54H68N12O12S2
Mol. Mass.1141.321
SMILESCC(CO)C(NC(=O)C1NC(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)CO)C(=O)NC(SS1)C(=O)N[C@@H](Cc1ccc2ccccc2c1)C(N)=O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: