Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM50024206
Substrate/Competitorn/a
Ki 100±n/a nM
CommentsPDSP_437
Citation Plassat JLAmlaiky NHen R Molecular cloning of a mammalian serotonin receptor that activates adenylate cyclase. Mol Pharmacol 44:229-36 (1993) [PubMed]  Article
More Info.:Get all data from this article
 
HTR6
Name:HTR6
Synonyms:5-HT6 | 5-hydroxytryptamine receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:47012.98
Organism:MOUSE
Description:5-HT6 HTR6 MOUSE::Q9R1C8
Residue:440
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC
RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS
PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS
GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
FVTDSVEPEIRQHPLGSPMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024206
n/a
NameBDBM50024206
Synonyms:3-[2-(dimethylamino)ethyl]-1H-indol-5-ol | 3-[2-(dimethylamino)ethyl]-5-indolol | 3-[2-(dimethylamino)ethyl]indol-5-ol | 3-[beta-(dimethylamino)ethyl]-5-hydroxyindole | 5-hydroxy-N,N-dimethyltryptamine | Bufotenin | Bufotenine | CHEMBL416526 | DM5-HT | DMT,5-OH | N,N-dimethylserotonin
TypeSmall organic molecule
Emp. Form.C12H16N2O
Mol. Mass.204.2682
SMILESCN(C)CCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: