Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50000078 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_226551 |
---|
Ki | 0.380000±n/a nM |
---|
Citation | de Costa, BR; Radesca, L; Di Paolo, L; Bowen, WD Synthesis, characterization, and biological evaluation of a novel class of N-(arylethyl)-N-alkyl-2-(1-pyrrolidinyl)ethylamines: structural requirements and binding affinity at the sigma receptor. J Med Chem35:38-47 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50000078 |
---|
n/a |
---|
Name | BDBM50000078 |
Synonyms: | (3,4-Dichloro-benzyl)-methyl-(2-pyrrolidin-1-yl-ethyl)-amine | CHEMBL143089 |
Type | Small organic molecule |
Emp. Form. | C14H20Cl2N2 |
Mol. Mass. | 287.228 |
SMILES | CN(CCN1CCCC1)Cc1ccc(Cl)c(Cl)c1 |
Structure |
|