| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50239169 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1665442 (CHEMBL4015238) |
|---|
| EC50 | 8810±n/a nM |
|---|
| Citation |  Pillaiyar, T; Köse, M; Sylvester, K; Weighardt, H; Thimm, D; Borges, G; Förster, I; von Kügelgen, I; Müller, CE Diindolylmethane Derivatives: Potent Agonists of the Immunostimulatory Orphan G Protein-Coupled Receptor GPR84. J Med Chem60:3636-3655 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 31473.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O14842 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
|---|
| BDBM50239169 |
|---|
| n/a |
|---|
| Name | BDBM50239169 |
|---|
| Synonyms: | CHEMBL4063898 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H20N2 |
|---|
| Mol. Mass. | 288.3862 |
|---|
| SMILES | CCCC(c1c[nH]c2ccccc12)c1c[nH]c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
