Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 12 |
---|
Ligand | BDBM50000334 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_162869 |
---|
EC50 | 1050±n/a nM |
---|
Citation | Meanwell, NA; Pearce, BC; Roth, HR; Smith, EC; Wedding, DL; Wright, JJ; Buchanan, JO; Baryla, UM; Gamberdella, M; Gillespie, E Inhibitors of blood platelet cAMP phosphodiesterase. 2. Structure-activity relationships associated with 1,3-dihydro-2H-imidazo[4,5-b]quinolin-2-ones substituted with functionalized side chains. J Med Chem35:2672-87 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 12 |
---|
Name: | P2Y purinoceptor 12 |
Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
Type: | Enzyme |
Mol. Mass.: | 39458.48 |
Organism: | Homo sapiens (Human) |
Description: | Q9H244 |
Residue: | 342 |
Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
BDBM50000334 |
---|
n/a |
---|
Name | BDBM50000334 |
Synonyms: | 6,7-Dichloro-1,5-dihydro-imidazo[2,1-b]quinazolin-2-one | 6,7-Dichloro-1,5-dihydro-imidazo[2,1-b]quinazolin-2-one(BL-4162A) | 6,7-Dichloro-1,5-dihydro-imidazo[2,1-b]quinazolin-2-one(anagrelide) | ANAGRELIDE | Agrylin | CHEMBL760 |
Type | Small organic molecule |
Emp. Form. | C10H7Cl2N3O |
Mol. Mass. | 256.088 |
SMILES | Clc1ccc2N=C3NC(=O)CN3Cc2c1Cl |t:5| |
Structure |
|