Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase
LigandBDBM50240188
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1667780
Ki 7.6±n/a nM
Citation Carta FVullo DOsman SMAlOthman ZSupuran CT Synthesis and carbonic anhydrase inhibition of a series of SLC-0111 analogs. Bioorg Med Chem 25:2569-2576 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240188
n/a
NameBDBM50240188
Synonyms:CHEMBL4098655
TypeSmall organic molecule
Emp. Form.C13H11FN4O5S
Mol. Mass.354.314
SMILESNS(=O)(=O)c1ccc(NC(=O)Nc2cc(ccc2F)[N+]([O-])=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: