Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50240533
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1668374
IC50 322±n/a nM
Citation Bender AMWeiner RLLuscombe VBCho HPNiswender CMEngers DWBridges TMConn PJLindsley CW Synthesis and evaluation of 4,6-disubstituted pyrimidines as CNS penetrant pan-muscarinic antagonists with a novel chemotype. Bioorg Med Chem Lett 27:2479-2483 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240533
n/a
NameBDBM50240533
Synonyms:CHEMBL4096143
TypeSmall organic molecule
Emp. Form.C25H25FN4O2
Mol. Mass.432.49
SMILESFc1ccccc1Oc1cc(ncn1)N1CCC(CC1)C(=O)N1CCc2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: