Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50170654 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1672043 (CHEMBL4022072) |
---|
Ki | 0.005000±n/a nM |
---|
Citation | Sguazzini, E; Schmidt, HR; Iyer, KA; Kruse, AC; Dukat, M Reevaluation of fenpropimorph as a? receptor ligand: Structure-affinity relationship studies at human? Bioorg Med Chem Lett27:2912-2919 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50170654 |
---|
n/a |
---|
Name | BDBM50170654 |
Synonyms: | (+-)-cis-4-(3-(4-tert-butylphenyl)-2-methylpropyl)-2,6-dimethylmorpholine | (2R,6S)-4-[3-(4-tert-butylphenyl)-2-methylpropyl]-2,6-dimethylmorpholine | CHEMBL372700 | cis-2,6-dimethyl-4-(3-(4-(1,1-dimethylethyl)phenyl)-2-methylpropyl)morpholine | cis-4-(3-(4-(1,1-dimethylethyl)phenyl)-2-methylpropyl)-2,6-dimethylmorpholine | cis-4-(3-(p-tert-butylphenyl)-2-methylpropyl)-2,6-dimethylmorpholine | cis-fenpropimorph | fenpropimorph | fenpropimorph cis-form | fenpropimorphe |
Type | Small organic molecule |
Emp. Form. | C20H33NO |
Mol. Mass. | 303.4821 |
SMILES | CC(CN1C[C@H](C)O[C@H](C)C1)Cc1ccc(cc1)C(C)(C)C |r| |
Structure |
|