Reaction Details |
| Report a problem with these data |
Target | Phospholipase A2, major isoenzyme |
---|
Ligand | BDBM50004505 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_156346 |
---|
IC50 | 4500±n/a nM |
---|
Citation | Bennion, C; Connolly, S; Gensmantel, NP; Hallam, C; Jackson, CG; Primrose, WU; Roberts, GC; Robinson, DH; Slaich, PK Design and synthesis of some substrate analogue inhibitors of phospholipase A2 and investigations by NMR and molecular modeling into the binding interactions in the enzyme-inhibitor complex. J Med Chem35:2939-51 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Phospholipase A2, major isoenzyme |
---|
Name: | Phospholipase A2, major isoenzyme |
Synonyms: | Group IB phospholipase A2 | PA21B_PIG | PLA2G1B | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 |
Type: | Hydrolase; monomer or homodimer |
Mol. Mass.: | 16279.83 |
Organism: | Sus scrofa (pig) |
Description: | Purchased from Sigma. |
Residue: | 146 |
Sequence: | MKFLVLAVLLTVGAAQEGISSRALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPV
DELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNTEITCNSKNNACEAFICNC
DRNAAICFSKAPYNKEHKNLDTKKYC
|
|
|
BDBM50004505 |
---|
n/a |
---|
Name | BDBM50004505 |
Synonyms: | (S)-O-(2-Hexadecanamidoisohexyl) phosphocholine | CHEMBL101828 |
Type | Small organic molecule |
Emp. Form. | C27H57N2O5P |
Mol. Mass. | 520.7256 |
SMILES | CCCCCCCCCCCCCCCC(=O)N[C@H](COP([O-])(=O)OCC[N+](C)(C)C)CC(C)C |
Structure |
|