| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-3 |
|---|
| Ligand | BDBM50370453 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1684945 |
|---|
| IC50 | 1000000±n/a nM |
|---|
| Citation |  Kaltner, H; Szabó, T; Fehér, K; André, S; Balla, S; Manning, JC; Szilágyi, L; Gabius, HJ Bivalent O-glycoside mimetics with S/disulfide/Se substitutions and aromatic core: Synthesis, molecular modeling and inhibitory activity on biomedically relevant lectins in assays of increasing physiological relevance. Bioorg Med Chem25:3158-3170 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-3 |
|---|
| Name: | Galectin-3 |
|---|
| Synonyms: | LEG3_MOUSE | Lgals3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27519.08 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_302220 |
|---|
| Residue: | 264 |
|---|
| Sequence: | MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPG
AYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGP
YGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN
NRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMK
NLREISQLGISGDITLTSANHAMI
|
|
|
|---|
| BDBM50370453 |
|---|
| n/a |
|---|
| Name | BDBM50370453 |
|---|
| Synonyms: | LACTOSE | Lactose, anhydrous |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H22O11 |
|---|
| Mol. Mass. | 342.2965 |
|---|
| SMILES | OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
