Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50256672 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1688161 (CHEMBL4038731) |
---|
EC50 | 253±n/a nM |
---|
Citation | Truong, PM; Hassan, SA; Lee, YS; Kopajtic, TA; Katz, JL; Chadderdon, AM; Traynor, JR; Deschamps, JR; Jacobson, AE; Rice, KC Modulation of opioid receptor affinity and efficacy via N-substitution of 9?-hydroxy-5-(3-hydroxyphenyl)morphan: Synthesis and computer simulation study. Bioorg Med Chem25:2406-2422 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50256672 |
---|
n/a |
---|
Name | BDBM50256672 |
Synonyms: | CHEMBL4078283 |
Type | Small organic molecule |
Emp. Form. | C25H29NO6 |
Mol. Mass. | 439.5009 |
SMILES | OC(=O)C(O)=O.[H][C@@]12CCC[C@@](CCN1C\C=C\c1ccccc1)([C@H]2O)c1cccc(O)c1 |r,THB:15:14:24:10.8.9| |
Structure |
|