| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50008293 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54610 (CHEMBL669623) |
|---|
| Ki | 0.00585±n/a nM |
|---|
| Citation |  Piper, JR; Malik, ND; Rhee, MS; Galivan, J; Sirotnak, FM Synthesis and antifolate evaluation of the 10-propargyl derivatives of 5-deazafolic acid, 5-deazaaminopterin, and 5-methyl-5-deazaaminopterin. J Med Chem35:332-7 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50008293 |
|---|
| n/a |
|---|
| Name | BDBM50008293 |
|---|
| Synonyms: | 2-{4-[(2,4-Diamino-pyrido[2,3-d]pyrimidin-6-ylmethyl)-prop-2-ynyl-amino]-benzoylamino}-pentanedioic acid | CHEMBL114733 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23N7O5 |
|---|
| Mol. Mass. | 477.4726 |
|---|
| SMILES | Nc1nc(N)c2cc(CN(CC#C)c3ccc(cc3)C(=O)NC(CCC(O)=O)C(O)=O)cnc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
