| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM83450 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146241 |
|---|
| IC50 | 15±n/a nM |
|---|
| Citation |  Bagley, JR; Thomas, SA; Rudo, FG; Spencer, HK; Doorley, BM; Ossipov, MH; Jerussi, TP; Benvenga, MJ; Spaulding, T New 1-(heterocyclylalkyl)-4-(propionanilido)-4-piperidinyl methyl ester and methylene methyl ether analgesics. J Med Chem34:827-41 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM83450 |
|---|
| n/a |
|---|
| Name | BDBM83450 |
|---|
| Synonyms: | ALFENTANIL | Alfentanil hydrochloride | MLS002320667 | N-[1-[2-(4-ethyl-5-keto-tetrazol-1-yl)ethyl]-4-(methoxymethyl)-4-piperidyl]-N-phenyl-propionamide;hydrochloride | N-[1-[2-(4-ethyl-5-oxidanylidene-1,2,3,4-tetrazol-1-yl)ethyl]-4-(methoxymethyl)piperidin-4-yl]-N-phenyl-propanamide;hydrochloride | N-[1-[2-(4-ethyl-5-oxo-1-tetrazolyl)ethyl]-4-(methoxymethyl)-4-piperidinyl]-N-phenylpropanamide;hydrochloride | N-[1-[2-(4-ethyl-5-oxotetrazol-1-yl)ethyl]-4-(methoxymethyl)piperidin-4-yl]-N-phenylpropanamide;hydrochloride | SMR001338813 | cid_64761 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H32N6O3 |
|---|
| Mol. Mass. | 416.5172 |
|---|
| SMILES | CCC(=O)N(c1ccccc1)C1(COC)CCN(CCn2nnn(CC)c2=O)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
