| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18512 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1694634 |
|---|
| IC50 | 101±n/a nM |
|---|
| Citation |  Thakkar, SS; Thakor, P; Ray, A; Doshi, H; Thakkar, VR Benzothiazole analogues: Synthesis, characterization, MO calculations with PM6 and DFT, in silico studies and in vitro antimalarial as DHFR inhibitors and antimicrobial activities. Bioorg Med Chem25:5396-5406 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21603.71 |
|---|
| Organism: | Bos taurus (Cattle) |
|---|
| Description: | P00376 |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
|---|
| BDBM18512 |
|---|
| n/a |
|---|
| Name | BDBM18512 |
|---|
| Synonyms: | 5-(4-chlorophenyl)-6-ethylpyrimidine-2,4-diamine | CHEMBL36 | Pyrimethamine (Pyr) | US11530198, Example Pyrimethamine | cid_4993 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H13ClN4 |
|---|
| Mol. Mass. | 248.711 |
|---|
| SMILES | CCc1nc(N)nc(N)c1-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
