| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Ligand | BDBM50233538 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1695945 |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Li, K; Ma, T; Cai, J; Huang, M; Guo, H; Zhou, D; Luan, S; Yang, J; Liu, D; Jing, Y; Zhao, L Conjugates of 18?-glycyrrhetinic acid derivatives with 3-(1H-benzo[d]imidazol-2-yl)propanoic acid as Pin1 inhibitors displaying anti-prostate cancer ability. Bioorg Med Chem25:5441-5451 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18248.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1502595 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
|---|
| BDBM50233538 |
|---|
| n/a |
|---|
| Name | BDBM50233538 |
|---|
| Synonyms: | 18beta-glycyrrhetic acid | 3beta-hydroxy-11-oxoolean-12-en-30-oic acid | CHEMBL230006 | US11660306, Example 18beta Glycyrrhetinic acid | glycyrrhetinic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H46O4 |
|---|
| Mol. Mass. | 470.6838 |
|---|
| SMILES | CC1(C)[C@@H](O)CC[C@@]2(C)[C@H]1CC[C@]1(C)[C@@H]2C(=O)C=C2[C@@H]3C[C@](C)(CC[C@]3(C)CC[C@@]12C)C(O)=O |r,t:19| |
|---|
| Structure | 
|
|---|
Search and Browse
