| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50270470 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1708182 (CHEMBL4059415) |
|---|
| Ki | 100±n/a nM |
|---|
| Citation |  Le Hiress, M; Akagah, B; Bernadat, G; Tu, L; Thuillet, R; Huertas, A; Phan, C; Fadel, E; Simonneau, G; Humbert, M; Jalce, G; Guignabert, C Design, Synthesis, and Biological Activity of New N-(Phenylmethyl)-benzoxazol-2-thiones as Macrophage Migration Inhibitory Factor (MIF) Antagonists: Efficacies in Experimental Pulmonary Hypertension. J Med Chem61:2725-2736 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50270470 |
|---|
| n/a |
|---|
| Name | BDBM50270470 |
|---|
| Synonyms: | CHEMBL4094592 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H13NO2S |
|---|
| Mol. Mass. | 271.334 |
|---|
| SMILES | Cc1ccc2oc(=S)n(Cc3cccc(O)c3)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
