| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2X purinoceptor 3 |
|---|
| Ligand | BDBM50274369 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1713981 (CHEMBL4124030) |
|---|
| IC50 | 9.0±n/a nM |
|---|
| Citation |  Tobinaga, H; Kameyama, T; Oohara, M; Kobayashi, N; Ohdan, M; Ishizuka, N; Kume, M; Tomari, M; Tanaka, Y; Takahashi, F; Kinoshita, H; Shimada, S; Shinohara, S; Kai, H Pyrrolinone derivatives as a new class of P2X3 receptor antagonists. Part 1: Initial structure-activity relationship studies of a hit from a high throughput screening. Bioorg Med Chem Lett28:2338-2342 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2X purinoceptor 3 |
|---|
| Name: | P2X purinoceptor 3 |
|---|
| Synonyms: | ATP receptor | Glucocorticoid receptor | P2RX3 | P2RX3_HUMAN | P2X purinoceptor 3 | P2X purinoceptor 3 (P2RX3) | P2X purinoceptor 3 (P2X3) | P2X3 | P2X3 purinoceptor | Purinergic receptor | p2x3 + hsa |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 44292.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P56373 |
|---|
| Residue: | 397 |
|---|
| Sequence: | MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH
|
|
|
|---|
| BDBM50274369 |
|---|
| n/a |
|---|
| Name | BDBM50274369 |
|---|
| Synonyms: | CHEMBL4126267 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H28N2O5 |
|---|
| Mol. Mass. | 472.5323 |
|---|
| SMILES | COc1ccc(cc1)C(=O)C1=C(O)C(=O)N(C1C1CCCCC1)c1ccc(cc1)-c1cc(C)no1 |c:11| |
|---|
| Structure | 
|
|---|
Search and Browse
