| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM321277 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1716892 |
|---|
| Ki | 48±n/a nM |
|---|
| Citation |  Donnier-Maréchal, M; Carato, P; Larchanché, PE; Ravez, S; Boulahjar, R; Barczyk, A; Oxombre, B; Vermersch, P; Melnyk, P Synthesis and pharmacological evaluation of benzamide derivatives as potent and selective sigma-1 protein ligands. Eur J Med Chem138:964-978 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20857.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q5BJF2 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
|---|
| BDBM321277 |
|---|
| n/a |
|---|
| Name | BDBM321277 |
|---|
| Synonyms: | N-[3-(benzylmethylamino)propyl]-3,5-dichlorobenzamide | US10179761, Compound 3.1.26 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H20Cl2N2O |
|---|
| Mol. Mass. | 351.27 |
|---|
| SMILES | CN(CCCNC(=O)c1cc(Cl)cc(Cl)c1)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
