| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-5 |
|---|
| Ligand | BDBM50277120 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1717607 |
|---|
| IC50 | 11000±n/a nM |
|---|
| Citation |  Boggu, PR; Venkateswararao, E; Manickam, M; Kim, Y; Jung, SH Discovery of novel 3-(hydroxyalkoxy)-2-alkylchromen-4-one analogs as interleukin-5 inhibitors. Eur J Med Chem139:290-304 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-5 |
|---|
| Name: | Interleukin-5 |
|---|
| Synonyms: | IL5_MOUSE | Il-5 | Il5 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15414.97 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1464308 |
|---|
| Residue: | 133 |
|---|
| Sequence: | MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQ
LCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE
FLGVMSTEWAMEG
|
|
|
|---|
| BDBM50277120 |
|---|
| n/a |
|---|
| Name | BDBM50277120 |
|---|
| Synonyms: | CHEMBL4161645 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H26O4 |
|---|
| Mol. Mass. | 378.4608 |
|---|
| SMILES | OCc1ccc(COc2coc3cccc(CC4CCCCC4)c3c2=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
