Reaction Details |
| Report a problem with these data |
Target | Interleukin-5 |
---|
Ligand | BDBM50277133 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1717607 |
---|
IC50 | 14000±n/a nM |
---|
Citation | Boggu, PR; Venkateswararao, E; Manickam, M; Kim, Y; Jung, SH Discovery of novel 3-(hydroxyalkoxy)-2-alkylchromen-4-one analogs as interleukin-5 inhibitors. Eur J Med Chem139:290-304 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-5 |
---|
Name: | Interleukin-5 |
Synonyms: | IL5_MOUSE | Il-5 | Il5 |
Type: | PROTEIN |
Mol. Mass.: | 15414.97 |
Organism: | Mus musculus |
Description: | ChEMBL_1464308 |
Residue: | 133 |
Sequence: | MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQ
LCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE
FLGVMSTEWAMEG
|
|
|
BDBM50277133 |
---|
n/a |
---|
Name | BDBM50277133 |
Synonyms: | CHEMBL4168965 |
Type | Small organic molecule |
Emp. Form. | C22H30O4 |
Mol. Mass. | 358.4712 |
SMILES | CCCc1oc2cccc(CC3CCCCC3)c2c(=O)c1OCCCO |
Structure |
|