Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50280113 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1721668 (CHEMBL4136668) |
---|
Kd | 94±n/a nM |
---|
Citation | Dawson, TK; Dziedzic, P; Robertson, MJ; Cisneros, JA; Krimmer, SG; Newton, AS; Tirado-Rives, J; Jorgensen, WL Adding a Hydrogen Bond May Not Help: Naphthyridinone vs Quinoline Inhibitors of Macrophage Migration Inhibitory Factor. ACS Med Chem Lett8:1287-1291 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM50280113 |
---|
n/a |
---|
Name | BDBM50280113 |
Synonyms: | CHEMBL4170679 |
Type | Small organic molecule |
Emp. Form. | C18H12FN5O4 |
Mol. Mass. | 381.3174 |
SMILES | OC(=O)Cn1ccc2ccc(nc2c1=O)-c1cn(nn1)-c1ccc(O)c(F)c1 |
Structure |
|