| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50206030 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1721668 (CHEMBL4136668) |
|---|
| Kd | 150±n/a nM |
|---|
| Citation |  Dawson, TK; Dziedzic, P; Robertson, MJ; Cisneros, JA; Krimmer, SG; Newton, AS; Tirado-Rives, J; Jorgensen, WL Adding a Hydrogen Bond May Not Help: Naphthyridinone vs Quinoline Inhibitors of Macrophage Migration Inhibitory Factor. ACS Med Chem Lett8:1287-1291 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50206030 |
|---|
| n/a |
|---|
| Name | BDBM50206030 |
|---|
| Synonyms: | CHEMBL3957289 | US10336721, Example 22 | US10968198, Example 22 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26FN5O4 |
|---|
| Mol. Mass. | 479.5034 |
|---|
| SMILES | Oc1ccc(cc1F)-n1cc(nn1)-c1ccc2cc(OCCOCCN3CCOCC3)ccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
